DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and pie-1

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001255166.1 Gene:pie-1 / 176667 WormBaseID:WBGene00004027 Length:335 Species:Caenorhabditis elegans


Alignment Length:113 Identity:29/113 - (25%)
Similarity:36/113 - (31%) Gaps:49/113 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 SRYKTELCRPFEEAGECKYGEKCQFAHGSHELRNVHRHPKY------------------------ 174
            :.|||.||..|...|.|.|.:.|.:|||..|||...|..:|                        
 Worm    97 TEYKTRLCDAFRREGYCPYNDNCTYAHGQDELRVPRRRQEYYSRDPPRERRDSRSRRDDVDTTIN 161

  Fly   175 ------------------------KTEYCRTFHSVGFCPYGPRCHFVH 198
                                    :.:.|..|.. |.|.|||||.|:|
 Worm   162 RSSSSASKHHDENRRPSNNHGSSNRRQICHNFER-GNCRYGPRCRFIH 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 11/24 (46%)
zf-CCCH 174..198 CDD:279036 11/71 (15%)
pie-1NP_001255166.1 zf-CCCH 99..125 CDD:279036 12/25 (48%)
ZnF_C3H1 184..210 CDD:214632 11/26 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12547
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.