DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and YCK2

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_014245.1 Gene:YCK2 / 855568 SGDID:S000005098 Length:546 Species:Saccharomyces cerevisiae


Alignment Length:343 Identity:164/343 - (47%)
Similarity:209/343 - (60%) Gaps:20/343 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ESRPE-IIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSG 72
            :||.: .|||..|::.:|||.||||.::.|.::.:|..||||.|......|||..|.:.|:||:|
Yeast    64 QSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAG 128

  Fly    73 GVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIH 137
            ..|.|:..:.|:|...|.||:|||||||||||::|.|.|::|||:.:..|||..:|.:|....|:
Yeast   129 TPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIY 193

  Fly   138 RDIKPDNFLMGIGR----HCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLG 198
            |||||||||  |||    ..||:.|||||:||::|||.|:.||.|||.|:|:|||||.|||.|||
Yeast   194 RDIKPDNFL--IGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLG 256

  Fly   199 IEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYL 263
            .|||||||||::|:|..||.||.|||||:||...:||||||.|||..|.:..|.:|.|.:|..||
Yeast   257 REQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDLAQGLPIQFGRYL 321

  Fly   264 NYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTML------------KQKTH-QGQPNP 315
            ...|:|.|||.|||...|.|...:...|....|..|||..|            |...| .|.|||
Yeast   322 EIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKLNGGRGWDLSINKKPNLHGYGHPNP 386

  Fly   316 AILLEQLDKDKEKQNGKP 333
            .....:..:.|..|...|
Yeast   387 PNEKSKRHRSKNHQYSSP 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 143/268 (53%)
Pkinase_Tyr 23..284 CDD:285015 142/264 (54%)
YCK2NP_014245.1 STKc_CK1_fungal 75..351 CDD:271029 145/277 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344366
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.