DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and ckl7

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001330873.1 Gene:ckl7 / 834433 AraportID:AT5G44100 Length:476 Species:Arabidopsis thaliana


Alignment Length:332 Identity:189/332 - (56%)
Similarity:260/332 - (78%) Gaps:13/332 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFP 77
            ::::|||:::.:||||||||::|||:::|:|||||:|:|:...:||||.||:|||.:|.||.|.|
plant     2 DLVIGGKFKLGKKIGSGSFGELYLGVNVQTGEEVAVKLENVKTKHPQLHYESKLYMLLQGGSGIP 66

  Fly    78 RIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKP 142
            .|:..|.|.:::.:|:||||||||||||:|.|..|:||||||.||::.|:|::|.:.|:||||||
plant    67 NIKWFGVEGDYSVMVIDLLGPSLEDLFNYCNRKLTLKTVLMLADQLLNRVEFMHTRGFLHRDIKP 131

  Fly   143 DNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDM 207
            ||||||:||..|::::|||||.||:||..|..||.|||:|||||||||||:|.|||:|||||||:
plant   132 DNFLMGLGRKANQVYIIDFGLGKKYRDLQTHKHIPYRENKNLTGTARYASVNTHLGVEQSRRDDL 196

  Fly   208 ESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFE 272
            ||||||:|||.:|.|||||:||.||:|||::|||||:|||||||||..|:||..|.:|||||||:
plant   197 ESLGYVLMYFLKGSLPWQGLKAGTKKQKYDRISEKKVSTPIEVLCKNQPSEFVSYFHYCRSLRFD 261

  Fly   273 EQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLK------------QKTHQGQPNPAILLEQLDKD 325
            ::|||.||::|||.||....:|:||::|||:||            :..|.....|....:.::: 
plant   262 DKPDYSYLKRLFRDLFIREGYQFDYVFDWTVLKYPQIGSSSGSSSRTRHHTTAKPGFNADPIER- 325

  Fly   326 KEKQNGK 332
            :|:..||
plant   326 QERILGK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 169/264 (64%)
Pkinase_Tyr 23..284 CDD:285015 168/260 (65%)
ckl7NP_001330873.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 174/273 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H111694
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X224
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.