DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and ckl4

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_194615.2 Gene:ckl4 / 829007 AraportID:AT4G28860 Length:414 Species:Arabidopsis thaliana


Alignment Length:308 Identity:194/308 - (62%)
Similarity:242/308 - (78%) Gaps:5/308 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFP 77
            |.|:||||::.||||.||||:|:|...|.:.|.||:|:|::..:||||||||||||.|.||.|.|
plant     2 ERIIGGKYKLGRKIGGGSFGEIFLATHIDTFEIVAVKIENSKTKHPQLLYEAKLYRTLEGGSGIP 66

  Fly    78 RIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKP 142
            |||..|.:...|.||||||||||||||.:|.|.|:.||||||.|||:.|:||:|.|.::||||||
plant    67 RIRWFGVDGTENALVMDLLGPSLEDLFVYCGRKFSPKTVLMLADQMLTRIEYVHSKGYLHRDIKP 131

  Fly   143 DNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDM 207
            ||||||:||..|:::||||||||::||.:|..||.|||:|||||||||||.|.||||||.||||:
plant   132 DNFLMGLGRKANQVYLIDFGLAKRYRDANTNRHIPYRENKNLTGTARYASCNTHLGIEQGRRDDL 196

  Fly   208 ESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFE 272
            ||||||::||.||.|||||:||..|:|||:||.|||:|||||||||..|.||:.|.:||.:|.|:
plant   197 ESLGYVLLYFLRGSLPWQGLKAVDKKQKYDKICEKKISTPIEVLCKSHPVEFASYFHYCHTLTFD 261

  Fly   273 EQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLK----QKTH-QGQPNP 315
            ::|||.:|::|||.||....:::|||||||::|    |||. |.|..|
plant   262 QRPDYGFLKRLFRDLFSREGYEFDYIYDWTIIKYQQSQKTRSQSQAVP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 171/264 (65%)
Pkinase_Tyr 23..284 CDD:285015 169/260 (65%)
ckl4NP_194615.2 PKc_like 8..282 CDD:419665 176/273 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X224
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.790

Return to query results.
Submit another query.