DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and CKI1

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_193170.1 Gene:CKI1 / 827076 AraportID:AT4G14340 Length:457 Species:Arabidopsis thaliana


Alignment Length:332 Identity:191/332 - (57%)
Similarity:257/332 - (77%) Gaps:5/332 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KESRPEIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSG 72
            :..:.:.::|||:::.||:||||||::|||::||:|||||:|:|....|||||.||:|:|..|.|
plant     3 RNQKMDHVIGGKFKLGRKLGSGSFGELYLGINIQTGEEVAVKLEPVKTRHPQLQYESKIYMFLQG 67

  Fly    73 GVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIH 137
            |.|.|.::..|.|..::.:|:||||||||||||:|.|.|::|:||||.||:|.|:||:|.:.|:|
plant    68 GTGVPHLKWFGVEGEYSCMVIDLLGPSLEDLFNYCKRIFSLKSVLMLADQLICRVEYMHSRGFLH 132

  Fly   138 RDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQS 202
            |||||||||||:||..|::::||:|||||::|..|:.||.|||:|||||||||||:|.|||||||
plant   133 RDIKPDNFLMGLGRRANQVYIIDYGLAKKYKDLQTQKHIPYRENKNLTGTARYASVNTHLGIEQS 197

  Fly   203 RRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCR 267
            ||||:||||||:|||.||.|||||:||.||:|||:|||||||.|.:|.|||..|:||:.|.:|||
plant   198 RRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYDKISEKKMLTSVETLCKSYPSEFTSYFHYCR 262

  Fly   268 SLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQ----KTHQGQPNPAILLEQLDKDKEK 328
            |||||::|||.|||:|||.||....:|.||::|||:.|.    .:.:.:|.|...|:......|:
plant   263 SLRFEDKPDYSYLRRLFRDLFIREGYQLDYVFDWTISKYPQIGSSSRPRPTPRPALDPPGPPAER 327

  Fly   329 QNGKPLI 335
            .. ||.:
plant   328 AE-KPTV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 171/264 (65%)
Pkinase_Tyr 23..284 CDD:285015 170/260 (65%)
CKI1NP_193170.1 STKc_CK1_delta_epsilon 14..288 CDD:271027 176/273 (64%)
PHA03307 <305..>436 CDD:223039 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H111694
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X224
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.