DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and AT4G08800

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_192620.1 Gene:AT4G08800 / 826451 AraportID:AT4G08800 Length:285 Species:Arabidopsis thaliana


Alignment Length:306 Identity:166/306 - (54%)
Similarity:215/306 - (70%) Gaps:33/306 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFP 77
            |:.:|.|:|:.||||||:||:||||..:||.|:||||.||....||||.||:::||:|..|.|.|
plant     2 ELRIGNKFRLGRKIGSGAFGEIYLGTDVQSNEDVAIKFESVKTVHPQLAYESRIYRVLQSGNGIP 66

  Fly    78 RIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKP 142
            .::.:||                          |::||||||.||||.|||:||.|.|:||||||
plant    67 NMKWYGK--------------------------FSLKTVLMLADQMINRLEFIHSKSFLHRDIKP 105

  Fly   143 DNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDM 207
            ||||||      |....|||||:|:||..:..||.|||:|:||||..|||:|.|||||||||||:
plant   106 DNFLMG------KAGKSDFGLARKYRDSSSYRHIPYRENKSLTGTPAYASLNTHLGIEQSRRDDV 164

  Fly   208 ESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFE 272
            |||||::|||.:|.|||:|:||..|:|||:||||||:||.||.||:|.|.||:.|::|||||||:
plant   165 ESLGYILMYFLKGSLPWKGLKAGNKKQKYDKISEKKVSTSIETLCEGHPIEFATYIHYCRSLRFD 229

  Fly   273 EQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKTHQGQPNPAIL 318
            ::|||.||::|||.||.....|:|:::|||:||..... .|.|:.|
plant   230 DKPDYAYLKRLFRDLFIREGFQFDFVFDWTVLKLPAIT-MPKPSTL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 149/264 (56%)
Pkinase_Tyr 23..284 CDD:285015 147/260 (57%)
AT4G08800NP_192620.1 PKc_like 8..250 CDD:304357 154/273 (56%)
SPS1 8..>205 CDD:223589 128/228 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 95 1.000 Domainoid score I2503
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.