DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and ckl10

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_188976.1 Gene:ckl10 / 821915 AraportID:AT3G23340 Length:442 Species:Arabidopsis thaliana


Alignment Length:325 Identity:199/325 - (61%)
Similarity:261/325 - (80%) Gaps:5/325 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRI 79
            ::|||:::.|||||||||::|:|:::|:|||||:|:|....:||||.||:|:|.:|.||.|.|.|
plant     4 VIGGKFKLGRKIGSGSFGELYIGINVQTGEEVALKLEPVKTKHPQLHYESKVYMLLQGGTGVPHI 68

  Fly    80 RHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDN 144
            :..|.|.|:|.:.:||||||||||||:|||.|::||||||.||:|.|:||:|.:.|:||||||||
plant    69 KWFGVEGNYNCMAIDLLGPSLEDLFNYCTRSFSLKTVLMLADQLINRVEYMHSRGFLHRDIKPDN 133

  Fly   145 FLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDMES 209
            ||||:||..|::::||:|||||:||..|..||.|||:|||||||||||:|.|||||||||||:||
plant   134 FLMGLGRKANQVYIIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLES 198

  Fly   210 LGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQ 274
            ||||:|||.||.|||||:||.||:|||||||||||.||:|||||..|:||:.|.:||||||||::
plant   199 LGYVLMYFIRGSLPWQGLKAGTKKQKYEKISEKKMLTPVEVLCKSYPSEFTSYFHYCRSLRFEDK 263

  Fly   275 PDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQ----KTHQGQPNPAILLEQLDKDKEKQNGKPLI 335
            |||.||::|||.||....:|:||::|||:||.    ...:.:|||...|:......|: |.||::
plant   264 PDYSYLKRLFRDLFIREGYQFDYVFDWTILKYPQSGSISKPRPNPKPALDPPGPSAER-NEKPIV 327

  Fly   336  335
            plant   328  327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 176/264 (67%)
Pkinase_Tyr 23..284 CDD:285015 175/260 (67%)
ckl10NP_188976.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 181/273 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H111694
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X224
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.