DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and ckl5

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_179537.1 Gene:ckl5 / 816466 AraportID:AT2G19470 Length:433 Species:Arabidopsis thaliana


Alignment Length:301 Identity:189/301 - (62%)
Similarity:244/301 - (81%) Gaps:1/301 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRIR 80
            ||.|:|:.|||||||||:||||..:|:.||||||:||....||||.||:::||:|.||.|.|.::
plant     5 VGNKFRLGRKIGSGSFGEIYLGTDVQTNEEVAIKLESVKTAHPQLSYESRIYRVLQGGTGIPNMK 69

  Fly    81 HHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNF 145
            .:|.|.::|.||||||||||||||::|.|.|::||||||.||||.|||:||.|.::|||||||||
plant    70 WYGVEGDYNVLVMDLLGPSLEDLFSYCKRQFSLKTVLMLADQMINRLEFIHSKSYLHRDIKPDNF 134

  Fly   146 LMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDMESL 210
            |||:||..|::::||:|||||:||..|..||.|||:|:|.||.||||:|.|||||||||||:|||
plant   135 LMGLGRRANQVYIIDYGLAKKYRDSSTHRHIPYRENKSLIGTPRYASLNTHLGIEQSRRDDIESL 199

  Fly   211 GYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQP 275
            ||::|||.:|.|||||:||..|:|||:||||||:||.||.||:|.|.||:.|.:|||||||:::|
plant   200 GYILMYFLKGSLPWQGLKAGNKKQKYDKISEKKVSTSIETLCRGHPTEFASYFHYCRSLRFDDKP 264

  Fly   276 DYMYLRQLFRILFRTLNHQYDYIYDWTMLK-QKTHQGQPNP 315
            ||.||::|||.||.....|:|:::|||:.| |::..|.|.|
plant   265 DYAYLKRLFRNLFIREGFQFDFVFDWTVYKYQQSQSGNPQP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 172/264 (65%)
Pkinase_Tyr 23..284 CDD:285015 170/260 (65%)
ckl5NP_179537.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 177/273 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X224
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.690

Return to query results.
Submit another query.