DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and VRK2

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001123952.1 Gene:VRK2 / 7444 HGNCID:12719 Length:508 Species:Homo sapiens


Alignment Length:300 Identity:93/300 - (31%)
Similarity:152/300 - (50%) Gaps:46/300 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GGKYRVIRKIGSGSFGDIYLGMSIQSGEEVA---IKMESAHARHPQLLYEAKLYRILS------- 71
            |.::.:.:|||||.||.|||.......|:.|   :|:|  :..:..|..|.|.|:.::       
Human    26 GNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVE--YQENGPLFSELKFYQRVAKKDCIKK 88

  Fly    72 -------GGVGFPRIRHHG----KEKNFNTLVMDLLGPSLEDLFNFCTRHFTIK--TVLMLVDQM 123
                   ..:|.|.....|    |.:::..:||:.||..|:.:..   ::.|.|  |||.|..:|
Human    89 WIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISG---QNGTFKKSTVLQLGIRM 150

  Fly   124 IGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYRED--KNLTG 186
            :..|||||...::|.|||..|.|:|. ::.::::|.|:||:  :|.....:|..|:|:  |...|
Human   151 LDVLEYIHENEYVHGDIKAANLLLGY-KNPDQVYLADYGLS--YRYCPNGNHKQYQENPRKGHNG 212

  Fly   187 TARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPW-QGMKANTKQQ--KYEKISEKKMSTPI 248
            |..:.|::||.|:..|||.|:|.|||.|:.:..|.||| |.:|.....|  |...:.|    .|.
Human   213 TIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDE----LPQ 273

  Fly   249 EVLCKGSPA-----EFSMYLNYCRSLRFEEQPDYMYLRQL 283
            .|| |.:|:     |.:.:|....||.::|:|:|..|:::
Human   274 SVL-KWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 92/297 (31%)
Pkinase_Tyr 23..284 CDD:285015 92/293 (31%)
VRK2NP_001123952.1 STKc_VRK2 16..314 CDD:271025 93/299 (31%)
SPS1 29..421 CDD:223589 92/296 (31%)
Interaction with MAP3K7. /evidence=ECO:0000269|PubMed:17709393 397..508
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.