DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and Vrk2

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_081536.2 Gene:Vrk2 / 69922 MGIID:1917172 Length:503 Species:Mus musculus


Alignment Length:309 Identity:89/309 - (28%)
Similarity:143/309 - (46%) Gaps:64/309 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GGKYRVIRKIGSGSFGDIYLGMSIQSGEEVA---IKMESAHARHPQLLYEAKLYRILS------- 71
            |.::.:.:.||||.||.|||........:.|   ||:|  :..:..|..|.|.|:..:       
Mouse    26 GNRWALGKMIGSGGFGLIYLAFPTNKPNKDARHVIKLE--YQENGPLFSELKFYQRAAKRECIQK 88

  Fly    72 -------GGVGFPRIRHHG----KEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIG 125
                   ..:|.|.....|    |.:::..:||:.||..|:.|.: ....|...|||.|..:|:.
Mouse    89 WIQQRKLDYLGIPVFYGFGLTDFKGRSYRFMVMERLGIDLQKLLD-QNGGFKKLTVLQLGIRMLD 152

  Fly   126 RLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYRED--KNLTGTA 188
            .|||||...::|.|||..|.|:.. .:.::::|.|:||:  :|.....:|..|:||  |...||.
Mouse   153 VLEYIHENEYVHGDIKAANLLLDF-TNPDRVYLADYGLS--YRYCPNGNHKQYQEDPRKGHNGTI 214

  Fly   189 RYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPI----- 248
            .:.|::||.|:..|||.|:|.|||.|:::..|.|||                |.|:..|:     
Mouse   215 EFTSLDAHKGVAPSRRSDVEILGYCMLHWLFGKLPW----------------EAKLDDPVAVQTA 263

  Fly   249 ---------EVLCKGSP-----AEFSMYLNYCRSLRFEEQPDYMYLRQL 283
                     |.:.|.:|     :|...||.|..:|.::::|||..|:::
Mouse   264 KTNLLDELPESVLKWAPSGSSCSELVKYLMYVHNLAYDDKPDYQKLKKI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 88/307 (29%)
Pkinase_Tyr 23..284 CDD:285015 88/303 (29%)
Vrk2NP_081536.2 PKc_like 16..314 CDD:389743 89/309 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..395
Interaction with MAP3K7. /evidence=ECO:0000250 392..503
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.