DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and Csnk1d

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_038942724.1 Gene:Csnk1d / 64462 RGDID:71031 Length:428 Species:Rattus norvegicus


Alignment Length:317 Identity:209/317 - (65%)
Similarity:255/317 - (80%) Gaps:4/317 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFP 77
            |:.||.:||:.||||||||||||||..|.:|||||||:|....:||||..|:|:|:::.||||.|
  Rat     2 ELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIP 66

  Fly    78 RIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKP 142
            .||..|.|.::|.:||:|||||||||||||:|.|::||||:|.||||.|:||||.|.|||||:||
  Rat    67 TIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKP 131

  Fly   143 DNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDM 207
            ||||||:|:..|.:::||||||||:||..|..||.|||:|||||||||||||.|||||||||||:
  Rat   132 DNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDL 196

  Fly   208 ESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFE 272
            ||||||:||||.|.|||||:||.||:||||:||||||||||||||||.|:||:.|||:||||||:
  Rat   197 ESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFD 261

  Fly   273 EQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKTHQGQPNPAILLEQLDKDKEKQ 329
            ::|||.|||||||.||......|||::||.|||    .|....|...|:..:|:|::
  Rat   262 DKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLK----FGASRAADDAERERRDREER 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 188/264 (71%)
Pkinase_Tyr 23..284 CDD:285015 186/260 (72%)
Csnk1dXP_038942724.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 193/273 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X224
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.