DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and Csnk1g1

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_017451375.1 Gene:Csnk1g1 / 64086 RGDID:621404 Length:467 Species:Rattus norvegicus


Alignment Length:335 Identity:166/335 - (49%)
Similarity:220/335 - (65%) Gaps:31/335 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKMRILKE--------SRPE--------IIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKM 50
            |:.|..|.        |||.        ::||..:||.:|||.|:||::.||.::.:.|.||||:
  Rat    10 DRQRTTKTMAQRNTHCSRPSGTSTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKL 74

  Fly    51 ESAHARHPQLLYEAKLYRIL-SGGVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIK 114
            |...:|.|||..|.:.|:.| |.|.|.|::.:.|....:|.:|::||||||||||:.|.|.||:|
  Rat    75 EPIKSRAPQLHLEYRFYKQLGSAGEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLK 139

  Fly   115 TVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNK----LFLIDFGLAKKFRDPHTRHH 175
            ||||:..|::.|:||:|.|..|:||:||:|||  |||..||    :.:|||||||::.||.|:.|
  Rat   140 TVLMIAIQLLSRMEYVHSKNLIYRDVKPENFL--IGRQGNKKEHVIHIIDFGLAKEYIDPETKKH 202

  Fly   176 IVYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKIS 240
            |.|||.|:|||||||.|||.|||.|||||||:|:||::.|||.||.|||||:||:|.:::|:||.
  Rat   203 IPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG 267

  Fly   241 EKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLK 305
            :.|.|||||.||:..|.|...||.|.|.|.|.|:|||.|||.||..||....:.:||.|||.   
  Rat   268 DTKRSTPIEALCENFPEEMMTYLRYVRRLDFFEKPDYEYLRNLFTDLFERKGYTFDYAYDWV--- 329

  Fly   306 QKTHQGQPNP 315
                 |:|.|
  Rat   330 -----GRPIP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 146/269 (54%)
Pkinase_Tyr 23..284 CDD:285015 144/265 (54%)
Csnk1g1XP_017451375.1 STKc_CK1_gamma 43..331 CDD:271028 155/297 (52%)
CK1gamma_C 331..429 CDD:403712 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.