DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and ttbk2b

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001313220.1 Gene:ttbk2b / 569881 ZFINID:ZDB-GENE-030131-8246 Length:928 Species:Danio rerio


Alignment Length:319 Identity:107/319 - (33%)
Similarity:159/319 - (49%) Gaps:23/319 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRI 79
            :|..::||::|||.|.||:||..:...:...||:|:|||......|..|..:.:.|.|.....|.
Zfish    16 MVRERWRVLKKIGGGGFGEIYEVLDHVNQVSVALKVESAQQPKQVLKMEVAVLKRLQGKDHVCRF 80

  Fly    80 RHHGKEKNFNTLVMDLLGPSLEDL-FNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPD 143
            ...|:...||.:||:|.|.:|.|| .|.....|::.|.|.|..|::..:|.||...|:||||||.
Zfish    81 VGCGRNDRFNYVVMELQGRNLADLRRNMSHGTFSVSTTLRLGRQILEAIESIHSVGFLHRDIKPS 145

  Fly   144 NFLMG-IGRHCNKLFLIDFGLAKKF-------RDPHTRHHIVYREDKNLTGTARYASINAHLGIE 200
            ||.|| :...|...:::|||||::|       |.|        |......||.||||||||...|
Zfish   146 NFAMGRLNSTCRTCYMLDFGLARQFTNSCQEVRPP--------RPVAGFRGTVRYASINAHKNKE 202

  Fly   201 QSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNY 265
            ..|.||:.||.|:::.|..|.|||:.:|..      |::...|.:....:|.|..|.|||::.::
Zfish   203 MGRHDDLWSLFYMLVEFMVGQLPWRKIKDK------EQVGNMKETYNHRLLLKHLPDEFSVFFDH 261

  Fly   266 CRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKTHQGQPNPAILLEQLDK 324
            ..:|.:..:|||..|..:|....::.|...:..|||..|..:........|...:||.:
Zfish   262 ISNLDYYTKPDYQLLMSVFDNSMKSYNVVENDPYDWEKLDSEDTLNVGTLATTAQQLTR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 97/273 (36%)
Pkinase_Tyr 23..284 CDD:285015 95/269 (35%)
ttbk2bNP_001313220.1 STKc_TTBK 20..281 CDD:270919 97/274 (35%)
SPS1 21..361 CDD:223589 106/314 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.