DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and csnk1g2a

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_005171263.1 Gene:csnk1g2a / 554152 ZFINID:ZDB-GENE-030131-6445 Length:452 Species:Danio rerio


Alignment Length:331 Identity:158/331 - (47%)
Similarity:222/331 - (67%) Gaps:23/331 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPR 78
            ::||..:||.:|||.|:||::.||.::.:.|.||||:|...:|.|||..|.:.|:.|....|.|:
Zfish    44 LMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGNAEGVPQ 108

  Fly    79 IRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPD 143
            :.:.|....:|.:|::||||||||||:.|.|.|::|||||:..|:|.|:|::|.:..|:||:||:
Zfish   109 VYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPE 173

  Fly   144 NFLMGIGRHCNK----LFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRR 204
            |||  :||...|    :.:|||||||::.||.|:.||.|||.|:|||||||.|||.|||.|||||
Zfish   174 NFL--VGRPGTKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRR 236

  Fly   205 DDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSL 269
            ||:|:||::.|||.||.|||||:||:|.:::|:||.:.|.:|||||||:..| |.:.||.|.|.|
Zfish   237 DDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFP-EMATYLRYVRRL 300

  Fly   270 RFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKTHQGQPNPAIL--------LEQLDKDK 326
            .|.|:|||.|||:||..||....:.:||.|||.        |:|.|..:        |:..::||
Zfish   301 DFFERPDYEYLRKLFTDLFDRNGYVFDYEYDWV--------GKPLPTPIGPMPSDTPLQPSNRDK 357

  Fly   327 EKQNGK 332
            .:...|
Zfish   358 AQPQTK 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 140/268 (52%)
Pkinase_Tyr 23..284 CDD:285015 138/264 (52%)
csnk1g2aXP_005171263.1 SPS1 49..415 CDD:223589 156/326 (48%)
STKc_CK1_gamma 49..335 CDD:271028 149/296 (50%)
CK1gamma_C 335..411 CDD:289378 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.