DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and csnk1g2

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_012817061.1 Gene:csnk1g2 / 548442 XenbaseID:XB-GENE-481191 Length:412 Species:Xenopus tropicalis


Alignment Length:290 Identity:148/290 - (51%)
Similarity:205/290 - (70%) Gaps:2/290 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPR 78
            ::||..:||.:|||.|:||::.||.::.:.|.||||:|...:|.|||..|.:.|:.|....|.|:
 Frog    40 LMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKQLGNTEGLPQ 104

  Fly    79 IRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPD 143
            :.:.|....:|.:|::||||||||||:.|.|.||:|||||:..|:|.|:||:|.|..::||:||:
 Frog   105 VYYFGPCGKYNAMVLELLGPSLEDLFDLCNRTFTLKTVLMIAVQLISRMEYVHAKSLVYRDVKPE 169

  Fly   144 NFLMGI--GRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDD 206
            |||:|.  .:....:.:|||||||::.||.|:.||.|||.|:|||||||.|||.|||.|||||||
 Frog   170 NFLLGRPGSKRQKTIHIIDFGLAKEYWDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDD 234

  Fly   207 MESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRF 271
            :|:||::.|||.||.|||||:||:|.:::|:||.:.|.:||:|:||...|.|.:.||.|.|.|.|
 Frog   235 LEALGHMFMYFLRGNLPWQGLKADTLKERYQKIGDTKRTTPVEILCNNFPEELATYLRYVRQLDF 299

  Fly   272 EEQPDYMYLRQLFRILFRTLNHQYDYIYDW 301
            .|:|||.|||:||..|.......:||.|||
 Frog   300 FEKPDYEYLRRLFTDLLDRRGLIFDYEYDW 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 138/266 (52%)
Pkinase_Tyr 23..284 CDD:285015 136/262 (52%)
csnk1g2XP_012817061.1 STKc_CK1_gamma 45..332 CDD:271028 146/285 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.