DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and vrk3

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001013586.1 Gene:vrk3 / 541443 ZFINID:ZDB-GENE-030131-246 Length:459 Species:Danio rerio


Alignment Length:224 Identity:68/224 - (30%)
Similarity:107/224 - (47%) Gaps:14/224 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 KLYRILSGGVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEY 129
            ||:::  ..:|.|.....|..:.:..||...:|..|:...:..|...:.|.||.|..:::..||:
Zfish   228 KLHKL--DFLGIPSCVGFGLHETYRFLVFPCMGQPLQTELDEGTGSLSEKNVLQLALRLLDSLEF 290

  Fly   130 IHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLT--GTARYAS 192
            ||.|.:.|.||...|..:....| .::||..||.|  ||......|:.||:.....  |...:.|
Zfish   291 IHEKEYAHADIHAGNIYIKSSSH-TEVFLSGFGHA--FRFCPGGKHVEYRQGSRTAHQGNISFIS 352

  Fly   193 INAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVL--C--- 252
            :::|.|...|||.|::||||.|:.:..|.|||..:..|:.....||  |:.||....:|  |   
Zfish   353 LDSHKGAGPSRRSDLQSLGYCMLCWMTGSLPWSHLSHNSSSVAAEK--ERYMSDVPGLLTYCYKQ 415

  Fly   253 KGSPAEFSMYLNYCRSLRFEEQPDYMYLR 281
            |.:.:....||....:|::.|:|||..|:
Zfish   416 KKASSALQEYLCNVMALQYTEKPDYTLLK 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 68/224 (30%)
Pkinase_Tyr 23..284 CDD:285015 68/224 (30%)
vrk3NP_001013586.1 DUF4758 <9..>104 CDD:292572
PK_VRK3 154..451 CDD:271026 68/224 (30%)
SPS1 236..>384 CDD:223589 47/150 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.