DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and CSNK1G1

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001316534.1 Gene:CSNK1G1 / 53944 HGNCID:2454 Length:475 Species:Homo sapiens


Alignment Length:319 Identity:162/319 - (50%)
Similarity:217/319 - (68%) Gaps:23/319 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SRPE--------IIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKL 66
            |||.        ::||..:||.:|||.|:||::.||.::.:.|.||||:|...:|.|||..|.:.
Human    26 SRPSGSSSSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRF 90

  Fly    67 YRIL-SGGVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYI 130
            |:.| |.|.|.|::.:.|....:|.:|::||||||||||:.|.|.||:|||||:..|::.|:||:
Human    91 YKQLGSAGEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYV 155

  Fly   131 HLKCFIHRDIKPDNFLMGIGRHCNK----LFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYA 191
            |.|..|:||:||:|||  |||..||    :.:|||||||::.||.|:.||.|||.|:|||||||.
Human   156 HSKNLIYRDVKPENFL--IGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYM 218

  Fly   192 SINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSP 256
            |||.|||.|||||||:|:||::.|||.||.|||||:||:|.:::|:||.:.|.:||||.||:..|
Human   219 SINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFP 283

  Fly   257 AEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKTHQGQPNP 315
            .|.:.||.|.|.|.|.|:|||.|||.||..||....:.:||.|||.        |:|.|
Human   284 EEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGYTFDYAYDWV--------GRPIP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 145/269 (54%)
Pkinase_Tyr 23..284 CDD:285015 143/265 (54%)
CSNK1G1NP_001316534.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.