DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and tptep2-csnk1e

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_012816439.1 Gene:tptep2-csnk1e / 496553 XenbaseID:XB-GENE-481480 Length:445 Species:Xenopus tropicalis


Alignment Length:325 Identity:213/325 - (65%)
Similarity:258/325 - (79%) Gaps:12/325 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFP 77
            |:.||.|||:.||||||||||||||.:|.:|||||||:|....:||||..|:|.|:::.||||.|
 Frog    31 ELRVGNKYRLGRKIGSGSFGDIYLGANIATGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIP 95

  Fly    78 RIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKP 142
            .|:..|.|.::|.:||:|||||||||||||:|.|::||||:|.||||.|:||||.|.|||||:||
 Frog    96 SIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKP 160

  Fly   143 DNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDM 207
            ||||||:|:..|.:::||||||||:||..|..||.|||:|||||||||||||.|||||||||||:
 Frog   161 DNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDL 225

  Fly   208 ESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFE 272
            ||||||:||||.|.|||||:||.||:||||:||||||||||||||||.|:|||.|||:||||||:
 Frog   226 ESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFD 290

  Fly   273 EQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKTHQGQPNPAILLEQLDK-----DKEKQNGK 332
            ::|||.|||||||.||......|||::||.|||   .....||    |.||:     |:|::.|:
 Frog   291 DKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLK---FGAARNP----EDLDRERREHDREERMGQ 348

  Fly   333  332
             Frog   349  348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 189/264 (72%)
Pkinase_Tyr 23..284 CDD:285015 186/260 (72%)
tptep2-csnk1eXP_012816439.1 STKc_CK1_delta_epsilon 37..311 CDD:271027 194/273 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3408
SonicParanoid 1 1.000 - - X224
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.