DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and csnk1g1

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_009301749.1 Gene:csnk1g1 / 494092 ZFINID:ZDB-GENE-041212-63 Length:466 Species:Danio rerio


Alignment Length:304 Identity:158/304 - (51%)
Similarity:212/304 - (69%) Gaps:14/304 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SRPE--------IIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKL 66
            |||.        ::||..:||.:|||.|:||::.||.::.:.|.||||:|...:|.|||..|.:.
Zfish    26 SRPSSSSASSGVLMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRF 90

  Fly    67 YRILSGGVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIH 131
            |:.|....|.|::.:.|....:|.:|::||||||||||:.|.|.|::|||||:..|:|.|:||:|
Zfish    91 YKTLGSADGLPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVH 155

  Fly   132 LKCFIHRDIKPDNFLMGIGRHCNK----LFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYAS 192
            .|..|:||:||:|||  |||..||    :.:|||||||::.||.|:.||.|||.|:|||||||.|
Zfish   156 SKNLIYRDVKPENFL--IGRQGNKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMS 218

  Fly   193 INAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPA 257
            ||.|||.|||||||:|:||::.|||.||.|||||:||:|.:::|:||.:.|.:|||||||:..|.
Zfish   219 INTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPE 283

  Fly   258 EFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDW 301
            |.:.||.|.|.|.|.|:|||.|||.||..||....:.:||.|||
Zfish   284 EMATYLRYVRRLDFFEKPDYDYLRNLFTELFDRKGYAFDYSYDW 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 144/268 (54%)
Pkinase_Tyr 23..284 CDD:285015 142/264 (54%)
csnk1g1XP_009301749.1 STKc_CK1_gamma 43..330 CDD:271028 153/287 (53%)
SPS1 43..>265 CDD:223589 119/223 (53%)
CK1gamma_C 330..417 CDD:289378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.