DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and ball

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster


Alignment Length:348 Identity:94/348 - (27%)
Similarity:141/348 - (40%) Gaps:43/348 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GKYRVIRKIGSGSFGDIYLGMSI-QSGEEVAIKMESAHARHPQL------LYEAKLYRILS---- 71
            |::|:...||.|.||:||....: :...:..:|.| .|...|..      |..|||..|..    
  Fly    45 GQWRIGPSIGVGGFGEIYAACKVGEKNYDAVVKCE-PHGNGPLFVEMHFYLRNAKLEDIKQFMQK 108

  Fly    72 ---GGVGFPRIRHHGK-----EKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLE 128
               ..:|.|.|..:|.     ||: ..:||...|..|........:.....||..|..||:...:
  Fly   109 HGLKSLGMPYILANGSVEVNGEKH-RFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQMLDVYQ 172

  Fly   129 YIHLKCFIHRDIKPDNFLMGIGR-HCNKLFLIDFGLAKKF------RDPHTRHHIVYREDKNLTG 186
            |:|...::|.|:|..|.|:|:.: ...:.:|:|||||..|      .||...|:          |
  Fly   173 YMHSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHFVTGDFKPDPKKMHN----------G 227

  Fly   187 TARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVL 251
            |..|.|.:||||: .:||.|:|.|||.::.:....|||...|......|.:|..|..|....|.|
  Fly   228 TIEYTSRDAHLGV-PTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESL 291

  Fly   252 ----CKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKTHQGQ 312
                .||.|.....::.|...|...::|||...|..|....:.|....:...|:.|..|.:....
  Fly   292 KTLFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKMKPQTSSNNN 356

  Fly   313 PNPAILLEQLDKDKEKQNGKPLI 335
            .:|....:.....|.|:...|::
  Fly   357 LSPPGTSKAATARKAKKIDSPVL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 84/294 (29%)
Pkinase_Tyr 23..284 CDD:285015 83/290 (29%)
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 85/295 (29%)
SPS1 47..432 CDD:223589 93/346 (27%)
Pol_alpha_B_N <399..>502 CDD:285602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452730
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.