DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and vrk1

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_998550.1 Gene:vrk1 / 406694 ZFINID:ZDB-GENE-040426-2709 Length:425 Species:Danio rerio


Alignment Length:362 Identity:99/362 - (27%)
Similarity:160/362 - (44%) Gaps:52/362 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RILKESRP--EIIVGG---KYRVIRKIGSGSFGDIYLGMSIQSGEEVA-----IKMESA------ 53
            |.|.|..|  |::...   |:::...:|.|.||.:||.....||...|     ||:|.:      
Zfish    18 RKLAEEFPSGEVLTDNAKKKWKLGSAVGQGGFGLLYLANEDSSGPVTADAPYVIKVEPSDNGPLF 82

  Fly    54 -------HARHPQLL---YEAKLYRILS----GGVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLF 104
                   .|..|.|:   .::|....|.    .|.||    |....|.:..:|||..|..|:.||
Zfish    83 SELKFYMRAAKPDLIGAWMKSKKMEYLGVPKYWGSGF----HEKNGKRYRFMVMDRFGTDLQKLF 143

  Fly   105 NFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRD 169
            ....:.|:.|.||.|..:::..|||||...::|.|||..|.|:.. .:.|::||:|:|||.::..
Zfish   144 EGNGKKFSRKLVLQLGLRLLDILEYIHDHEYVHADIKASNLLLSY-TNPNQVFLVDYGLAYRYAP 207

  Fly   170 PHTRHHIVYREDKNL--TGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTK 232
            ......  |:||...  .||..:.||:||.|:..|||.|:|.:||.|:.:....|||:.   ..:
Zfish   208 EGVPKE--YKEDPKRCHDGTIEFTSIDAHKGVSPSRRADLEIMGYCMIQWLCSRLPWED---KLQ 267

  Fly   233 QQKYEKISEKKMSTPIEVLCKGS------PAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTL 291
            ...|.:.|:.:....|:...|..      |||...::...:.|.:.::|||..||.:.:...:::
Zfish   268 DPLYVRDSKLRCRDNIDEFLKSCFASGNIPAEMGKFMQEVKVLGYTDRPDYDKLRGILQQGLKSI 332

  Fly   292 NHQYDYIYDWTMLKQKTHQGQPNPAILLEQLDKDKEK 328
            ....|...|:.:....|..    |::...:..|.:||
Zfish   333 GSTDDKKLDFGVATNSTSL----PSVKTPKRKKAEEK 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 87/297 (29%)
Pkinase_Tyr 23..284 CDD:285015 86/293 (29%)
vrk1NP_998550.1 PKc_like 27..327 CDD:304357 88/309 (28%)
SPS1 37..>265 CDD:223589 74/237 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 343..425 5/27 (19%)
GAGA_bind <373..>424 CDD:283799
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.