DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and vrk2

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_957464.2 Gene:vrk2 / 394145 ZFINID:ZDB-GENE-040426-1046 Length:574 Species:Danio rerio


Alignment Length:375 Identity:107/375 - (28%)
Similarity:166/375 - (44%) Gaps:79/375 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILKESRPEIIVGGKYRVIRKIGSGSFGDIYL-----GMSIQSGEEVAIKMESAHARHPQLLYEAK 65
            ||.:|..:     .:|:.:.||.|.||.|||     .:.::...:..||:| .|...| |..|.|
Zfish    17 ILTDSEKK-----NWRIGKMIGKGGFGLIYLASQDVNVPVRDDADFVIKVE-YHENGP-LFSELK 74

  Fly    66 LYRILS--------------GGVGFPRIRHHG-KEKN---FNTLVMDLLGPSLEDLFNFCTRHFT 112
            .|:..:              |.:|.|.....| .|.|   :..:|||.||..|:.:.........
Zfish    75 FYQRAAKPETMSKWMKSKQLGFLGIPTYWGSGLTESNGTRYRFMVMDRLGTDLQKVLIDNGGQLR 139

  Fly   113 IKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIV 177
            ..:||.|...|:..|||||...::|.|||..|.|:|. |..||::|.|:||:.:: .|:..|. .
Zfish   140 KTSVLQLGVLMLDVLEYIHDNEYVHADIKAANLLLGY-RDPNKVYLADYGLSYRY-CPNGEHK-E 201

  Fly   178 YRED--KNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPW--------QGMKANTK 232
            |:|:  |...||..|.||:||.|:..|||.|::.|||.::::..|.|||        :..:|..|
Zfish   202 YKENPKKGHNGTIEYTSIDAHKGVAASRRGDLKVLGYCLLHWQCGTLPWLPSLKNPAEVQEAKAK 266

  Fly   233 QQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRT-LNHQYD 296
            .......|..||||      ..|..|.:.:|:..:.|.:.|:|||..||.   :|..| |....|
Zfish   267 LMSNLPDSVLKMST------SSSSMEIAQFLSRVKDLGYNEKPDYQALRM---VLSATGLQGPLD 322

  Fly   297 YIYDWTMLKQKTHQ--------------------GQPNPAILLEQLDKDK 326
                  :.:|:..:                    |:..||:..|::|:::
Zfish   323 ------LSRQRASETVRPTTQRAASQPKTTEKKMGRSKPAVTAEEIDEEQ 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 94/297 (32%)
Pkinase_Tyr 23..284 CDD:285015 93/293 (32%)
vrk2NP_957464.2 STKc_VRK2 13..313 CDD:271025 97/314 (31%)
SPS1 25..406 CDD:223589 104/362 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.