DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and bsd

DIOPT Version :10

Sequence 1:NP_511140.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_610733.1 Gene:bsd / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster


Alignment Length:166 Identity:55/166 - (33%)
Similarity:84/166 - (50%) Gaps:12/166 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 HRDIKPD--NFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGI 199
            |.|..|.  .||.....|   :||||||||.||:|.......:..:.:...||..:.|.:|||| 
  Fly   503 HLDNNPTEYKFLPTEEEH---VFLIDFGLASKFQDRGVHRPFIMDQRRAHDGTLEFTSRDAHLG- 563

  Fly   200 EQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVL----CKGSPAEFS 260
            ..|||.|:|.|||.::|::.|.|||:.:....:|:|..:..|..|:...|:|    .|..|....
  Fly   564 AHSRRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEMLRQFYGKQVPKYLG 628

  Fly   261 MYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYD 296
            .:|.....|.::|:|:|...|::|:..::.|.  ||
  Fly   629 EFLLQIGQLAYQERPNYERYRKIFKREYQRLG--YD 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_511140.1 Protein Kinases, catalytic domain 19..284 CDD:473864 51/152 (34%)
bsdNP_610733.1 Protein Kinases, catalytic domain 112..>286 CDD:473864
Protein Kinases, catalytic domain <517..652 CDD:473864 46/138 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.