DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and Vrk1

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001012194.1 Gene:Vrk1 / 362779 RGDID:1306069 Length:414 Species:Rattus norvegicus


Alignment Length:319 Identity:87/319 - (27%)
Similarity:149/319 - (46%) Gaps:39/319 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IGSGSFGDIYL-----GMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGG------------ 73
            ||.|.||.|||     ...:.|.....:|:|.:.  :..|..|.|.|:..:..            
  Rat    43 IGQGGFGCIYLADTNSSKPVGSDAPCVVKVEPSD--NGPLFTELKFYQRAAKPEQIQKWIHTHKL 105

  Fly    74 --VGFPRI----RHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHL 132
              :|.|:.    .|....|::..::||..|..|:.::....:.|:.||||.|..:::..|||||.
  Rat   106 KYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHE 170

  Fly   133 KCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNL--TGTARYASINA 195
            ..::|.|||..|.|:.. ::.::::|:|:|||.::.....  |..|:||...  .||..:.||:|
  Rat   171 HEYVHGDIKASNLLLSY-KNPDQVYLVDYGLAYRYCPDGV--HKEYKEDPKRCHDGTLEFTSIDA 232

  Fly   196 HLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVL---C---KG 254
            |.|:..|||.|:|.|||.|:.:..|.|||:.   |.|...|.:.|:.:....:..|   |   :.
  Rat   233 HNGVAPSRRGDLEILGYCMIQWLSGCLPWED---NLKDPNYVRQSKIRYRDNVAALMEKCFPERN 294

  Fly   255 SPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKTHQGQP 313
            .|.|.:.|:...:.|.:.|:|.|..||.:.....:.:..:.|...|::.::..:...:|
  Rat   295 KPGEIAKYMETVKLLDYTEKPLYQNLRDILLQGLKAIGSKDDGKLDFSAVENGSVNTKP 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 84/288 (29%)
Pkinase_Tyr 23..284 CDD:285015 84/288 (29%)
Vrk1NP_001012194.1 STKc_VRK1 26..326 CDD:271024 84/290 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.