DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and Vrk3

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001005561.2 Gene:Vrk3 / 361565 RGDID:1549692 Length:462 Species:Rattus norvegicus


Alignment Length:224 Identity:58/224 - (25%)
Similarity:108/224 - (48%) Gaps:20/224 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EKNFNTLVMDLLGPSLEDLFNFCTRH-FTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMG 148
            :..:..||...||.||:...:...:| .:.:.:|.:..:::..|||:|...::|.::..:|..:.
  Rat   239 QDKYRFLVFPSLGRSLQSALDDNPKHVVSERCMLQVACRLLDALEYLHEHEYVHGNLTTENVFVN 303

  Fly   149 IGRHCNKLFLIDFGLAKKFRDPHTRHHIVYRE-DKNL-TGTARYASINAHLGIEQSRRDDMESLG 211
             ....:::.|:.:|...:: .|..: |:.|:| .::| .|...:.|::.|.|...|||.|:::||
  Rat   304 -PEDLSQVTLVGYGFTYRY-CPGGK-HVAYKEGSRSLHDGDLEFISMDVHKGCGPSRRSDLQTLG 365

  Fly   212 YVMMYFNRGVLPWQGMKANTKQ-----QKYEKISEKKMSTPIEVLC---KGSPAEFSMYLNYCRS 268
            |.|:.:..|.|||.....||::     |||:...|     |:..||   ..:......||....:
  Rat   366 YCMLKWLYGSLPWTNCLPNTEEITKQKQKYQDNPE-----PLVGLCGRWNKTSETLREYLKVVMA 425

  Fly   269 LRFEEQPDYMYLRQLFRILFRTLN-HQYD 296
            |.:||:|.|..||....:|.:.:. ..||
  Rat   426 LDYEEKPPYATLRNNLEVLLQNMRVSPYD 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 55/209 (26%)
Pkinase_Tyr 23..284 CDD:285015 55/209 (26%)
Vrk3NP_001005561.2 zinc_ribbon_2 13..35 CDD:289981
DZR 14..>38 CDD:289539
PKc_like 143..445 CDD:304357 55/213 (26%)
SPS1 229..>458 CDD:223589 58/224 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.