DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and Vrk2

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_008768654.1 Gene:Vrk2 / 360991 RGDID:1311585 Length:503 Species:Rattus norvegicus


Alignment Length:296 Identity:92/296 - (31%)
Similarity:146/296 - (49%) Gaps:38/296 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GGKYRVIRKIGSGSFGDIYLGMSIQSGEEVA---IKMESAHARHPQLLYEAKLYRILS------- 71
            |.::.:.:.||||.||.|||.......|:.|   ||:|  :..:..|..|.|.|:..:       
  Rat    26 GNQWALGKMIGSGGFGLIYLAFPTNKPEKDARHVIKVE--YQENGPLFSELKFYQRAAKRECIQK 88

  Fly    72 -------GGVGFPRIRHHG----KEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIG 125
                   ..:|.|.....|    |.:::..:||:.||..|:.|.| ....|...|||.|..:|:.
  Rat    89 WVKQRKLDYLGVPVFYGFGLTDFKGRSYRFMVMERLGIDLQKLLN-QNGAFKKLTVLQLGIRMLD 152

  Fly   126 RLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYRED--KNLTGTA 188
            .|||||...::|.|||..|.|:|.. :.::::|.|:||:  :|.....:|..|.||  |...||.
  Rat   153 VLEYIHENEYVHGDIKAANLLLGYA-NPDRVYLADYGLS--YRYCPNGNHKQYHEDPRKGHNGTL 214

  Fly   189 RYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKAN--TKQQKYEKISEKKMSTPIEVL 251
            .:.|::||.|:..|||.|:|.|||.|:.:..|.|||:....|  ..|....|:.::...:.::..
  Rat   215 EFTSLDAHKGVAPSRRSDVEILGYCMLRWLCGKLPWETNLENPVAVQTAKTKLLDELPESVLKWT 279

  Fly   252 CKGSP----AEFSMYLNYCRSLRFEEQPDYMYLRQL 283
            ..||.    |||.||::   :|.::.:|||..|:::
  Rat   280 TSGSSCRELAEFFMYVH---NLAYDAKPDYQKLKKI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 91/294 (31%)
Pkinase_Tyr 23..284 CDD:285015 91/290 (31%)
Vrk2XP_008768654.1 PKc_like 16..314 CDD:304357 92/296 (31%)
Pkinase 29..290 CDD:278497 81/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.