DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and CG9962

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster


Alignment Length:280 Identity:143/280 - (51%)
Similarity:180/280 - (64%) Gaps:0/280 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRIRHHGKEK 86
            ||||:|||||||||....:.||..||:|:|..:|....|..|:.:|.:|..|:|.|........:
  Fly    17 VIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFSNR 81

  Fly    87 NFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGR 151
            ..:.|||:|||||||.||..|.|.|::||||||.|||:.||||:||..::||||||:|||||:|.
  Fly    82 RHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMGVGL 146

  Fly   152 HCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVMMY 216
            ..::|.||||||:|::.|.....|:..|......|||||||:||.....||||||:||:|||::|
  Fly   147 TRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYVLIY 211

  Fly   217 FNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLR 281
            ..||.|||||:..|:|.||.|.|.|.|:||....||.|.|.||..|:.|.|.|.|||:|||..:|
  Fly   212 LLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDYRMIR 276

  Fly   282 QLFRILFRTLNHQYDYIYDW 301
            ..|..|...|....|.||||
  Fly   277 CTFLSLLFNLKFTNDLIYDW 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 135/261 (52%)
Pkinase_Tyr 23..284 CDD:285015 134/260 (52%)
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 125/241 (52%)
STKc_CK1 17..279 CDD:270918 135/261 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452714
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.