DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and CG2577

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster


Alignment Length:337 Identity:191/337 - (56%)
Similarity:249/337 - (73%) Gaps:3/337 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MRILKESRPEIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYR 68
            |..|:.|:...:..|.|:|:||||.|||||||||:.|.|||.||||:||:..|||||.||.::||
  Fly     1 MERLRSSQNREVRIGNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYR 65

  Fly    69 ILSGGVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLK 133
            .|....|.||||:..||:::..:||||||||||.||.||.|.|||||||:|.:||:.|:||:|.:
  Fly    66 ALRPAHGLPRIRYFHKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNR 130

  Fly   134 CFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLG 198
            .|:||||||||||||:|....:::||||||:||:.|..|..||.|||:::||||||||||.||.|
  Fly   131 GFLHRDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAG 195

  Fly   199 IEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYL 263
            :|.:|||||.::|||:||||||.||||.:||:|||||||:|.|||:|..|||||:|.|.||:|||
  Fly   196 VESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYL 260

  Fly   264 NYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKTHQGQPNPAI---LLEQLDKD 325
            ||||.:.|.::|:|.::.::||:|...||.:...||||.||..|.|..|.||.|   :.....|:
  Fly   261 NYCRGMGFYDKPNYDFICRMFRMLRNGLNLRPGLIYDWDMLMMKFHNTQKNPGIGMRVFPPKQKE 325

  Fly   326 KEKQNGKPLIAD 337
            .:..:|:|:|.|
  Fly   326 DDGISGEPIIKD 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 165/264 (63%)
Pkinase_Tyr 23..284 CDD:285015 163/260 (63%)
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 165/264 (63%)
SPS1 16..>242 CDD:223589 145/225 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469570
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.