DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and Ttbk2

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_006234899.2 Gene:Ttbk2 / 311349 RGDID:1311661 Length:1311 Species:Rattus norvegicus


Alignment Length:297 Identity:109/297 - (36%)
Similarity:152/297 - (51%) Gaps:23/297 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPR 78
            |:|..:::|:||||.|.||:||..:.:.:.|.||:|:|||......|..|..:.:.|.|.....|
  Rat    84 ILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCR 148

  Fly    79 IRHHGKEKNFNTLVMDLLGPSLEDLFNFCTR-HFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKP 142
            ....|:...||.:||.|.|.:|.||....:| .|||.|.|.|..|::..:|.||...|:||||||
  Rat   149 FIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGKQILESIESIHSVGFLHRDIKP 213

  Fly   143 DNFLMG-IGRHCNKLFLIDFGLAKKF-------RDPHTRHHIVYREDKNLTGTARYASINAHLGI 199
            .||.|| ....|.|.|::|||||::|       |.|        |......||.||||||||...
  Rat   214 SNFAMGRFPSTCRKCFMLDFGLARQFTNSCGDVRPP--------RAVAGFRGTVRYASINAHRNR 270

  Fly   200 EQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLN 264
            |..|.||:.||.|:::.|..|.|||:.:|..      |::...|......::.|..|.|||.:|:
  Rat   271 EMGRHDDLWSLFYMLVEFVVGQLPWRKIKDK------EQVGSIKERYDHRLMLKHLPPEFSTFLD 329

  Fly   265 YCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDW 301
            :..||.:..:|||..|..:|....:|........:||
  Rat   330 HISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDW 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 103/273 (38%)
Pkinase_Tyr 23..284 CDD:285015 102/269 (38%)
Ttbk2XP_006234899.2 STKc_TTBK2 89..350 CDD:271031 103/274 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.