DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and cki2

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_595380.1 Gene:cki2 / 2541341 PomBaseID:SPBP35G2.05c Length:435 Species:Schizosaccharomyces pombe


Alignment Length:292 Identity:158/292 - (54%)
Similarity:205/292 - (70%) Gaps:2/292 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRI 79
            :||..|||.||||.||||.|:.||::.:.:.:|||.|...:..|||..|.:.|::|.|..|.|.:
pombe     7 VVGVHYRVGRKIGEGSFGVIFDGMNLLNNQLIAIKFEPKKSEAPQLRDEYRTYKLLVGNAGIPNV 71

  Fly    80 RHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDN 144
            .:.|:|...|.||:|||||||||||.:|.|.|::|||.|...||:.|::.||.|..::|||||||
pombe    72 YYFGQEGLHNILVIDLLGPSLEDLFEWCGRRFSVKTVAMTAKQMLSRVQTIHEKNLVYRDIKPDN 136

  Fly   145 FLMG--IGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDM 207
            ||:|  ..|:.|.::::|||:||.:|||.|:.||.|.|.|:|:|||||.|||.|||.|||||||:
pombe   137 FLIGRPSSRNANMVYMVDFGMAKYYRDPKTKQHIPYSERKSLSGTARYMSINTHLGREQSRRDDL 201

  Fly   208 ESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFE 272
            ||||:|.|||.||.|||||:||...:.|||||||||.||.|..||.|.|.|||.|:.|.|||.|:
pombe   202 ESLGHVFMYFLRGSLPWQGLKAANNKHKYEKISEKKQSTSISELCAGFPNEFSKYMTYVRSLEFD 266

  Fly   273 EQPDYMYLRQLFRILFRTLNHQYDYIYDWTML 304
            |:|||.:|::||..:.|......|.:|||.:|
pombe   267 EEPDYAFLQELFDDVLRANGDTNDGVYDWMLL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 148/266 (56%)
Pkinase_Tyr 23..284 CDD:285015 145/262 (55%)
cki2NP_595380.1 SPS1 11..378 CDD:223589 156/288 (54%)
STKc_CK1_fungal 11..287 CDD:271029 151/275 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.