DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and ZC373.3

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001257094.1 Gene:ZC373.3 / 191145 WormBaseID:WBGene00013868 Length:321 Species:Caenorhabditis elegans


Alignment Length:252 Identity:71/252 - (28%)
Similarity:123/252 - (48%) Gaps:18/252 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILKESRPEIIVGGKYRVIRKIGSGSFGDIYLGMSIQSG---EEVAIKMESAHARHPQ-LLY--EA 64
            :.|.:|    :..:|::|.|:||||||:::.......|   :.|.|..:......|: :||  |.
 Worm    26 LAKNNR----IAKRYKLIHKVGSGSFGEVWQATDKLEGNVAKIVKIINKYVGGSGPRDILYDNEI 86

  Fly    65 KLYRILSGGVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEY 129
            :.::........|.:.||.....||.|||...|.:|.::.......|::..::.:..|:...|.:
 Worm    87 EFFKYCHDAPNIPTLFHHFSHVGFNVLVMSEEGQNLREVAKRSPGSFSLNNLIRIAYQIGSTLCF 151

  Fly   130 IHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASIN 194
            ||.|.|||||:|.:|.|:.:.....|:.|||||.|.:|:|.:......:.:..:.| ...:.|||
 Worm   152 IHDKSFIHRDLKAENVLVSLKNKVCKMVLIDFGNAVRFKDVNGNELPEFNDGFDYT-HCTHKSIN 215

  Fly   195 AHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVL 251
            ..|||..::.||..||.|:::..: || .|   .:.|.:....|:..:  :.|.|:|
 Worm   216 VLLGISHTQNDDWASLVYLLLEMH-GV-TW---GSRTGEMFMNKVEFE--ANPTEIL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 69/239 (29%)
Pkinase_Tyr 23..284 CDD:285015 68/235 (29%)
ZC373.3NP_001257094.1 PKc_like 35..>236 CDD:389743 61/201 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.