DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and W09C3.1

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_491433.2 Gene:W09C3.1 / 189309 WormBaseID:WBGene00021109 Length:439 Species:Caenorhabditis elegans


Alignment Length:335 Identity:86/335 - (25%)
Similarity:159/335 - (47%) Gaps:30/335 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GGK--YRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRI 79
            |||  :..||::|.|:||.:|...:..:.:|.|:|:|...|....|.:|.::...:........|
 Worm    28 GGKIAWLTIRELGRGAFGTVYHVSNKSTKQEAALKIEKMTAGDNLLKFEREIMVAMQHEPTAIHI 92

  Fly    80 RHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDN 144
            ...|..|::..:||.|.||.|:.:......:|...|::.:..:.:..::.:|...:||||:||.|
 Worm    93 YDDGIYKDYRYIVMTLCGPDLQKIAELMNNNFNQDTIIRVCIRTLLAIKTMHEYTYIHRDLKPCN 157

  Fly   145 FLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKN---LTGTARYASINAHLGIEQSRRDD 206
            |.:....:...::|.|:|:|:|:....:.:....|..:|   ..||.||.|:|.|...|.||.||
 Worm   158 FAVDFNPNSLHVYLFDYGMARKYATKDSGNKWQLRRPRNPAQFRGTVRYCSLNMHKRKELSRVDD 222

  Fly   207 MESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGS-PAEFSMYLNYCRSLR 270
            :.|..:::|.. ...|||   .::...::.|.:.|..::   |.|.|.| .:.|...:.|..|::
 Worm   223 LWSWFFMLMEM-YAPLPW---TSSNIPERIEALKEDHLN---EYLSKDSFLSSFLPLVEYLNSVQ 280

  Fly   271 FEEQPDYMYLRQLFRILFRTLNH---------QYDYIYDWTMLKQKTHQGQPNPAILLEQLDKDK 326
            :.::||||   :::.||:..|..         :||......::.:.....:|..   |.::|.:.
 Worm   281 YADRPDYM---KIYDILYAKLTEINGKLSGPMKYDVARINALVAELGETARPKE---LSRMDDES 339

  Fly   327 EKQNGKPLIA 336
            ..|  |.|:|
 Worm   340 TIQ--KYLLA 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 72/270 (27%)
Pkinase_Tyr 23..284 CDD:285015 71/264 (27%)
W09C3.1NP_491433.2 PKc_like 33..294 CDD:389743 71/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.