DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and T19D12.5

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_495349.1 Gene:T19D12.5 / 188608 WormBaseID:WBGene00020580 Length:361 Species:Caenorhabditis elegans


Alignment Length:328 Identity:81/328 - (24%)
Similarity:146/328 - (44%) Gaps:55/328 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IGSGSFGDIYLGMSIQSGEEVAIKMESAHAR---HPQLLYEAKLYRILSGGVGFPRIRHHGKEKN 87
            ||.|.:|:|||.:.:..|||||||:|....|   ..:::.|..:...:.|....|.|...|..:.
 Worm    68 IGKGGYGEIYLALDVVRGEEVAIKVEPKKRRGKLAKRMILEQHVLAKMQGKPHVPMIYGSGHAEK 132

  Fly    88 FNTLVMDLLGPSLEDL--------FNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDN 144
            :|.::|.:|..::.|:        .:.|       :|..::.|:|..|:.:|...::|||:||.|
 Worm   133 YNFIIMQILSINVGDIKKSSPNKKLSQC-------SVGRIIHQVIAALQDLHETGYVHRDVKPAN 190

  Fly   145 FLMGIGRHC-NKLFLIDFGLAKKF-------RDPHTRHHIVYREDKNLTGTARYASINAHLGIEQ 201
            ...||..|. :.|.|:||||.:::       |:|..|        ....||.||.||..|...||
 Worm   191 MCFGIFPHSRHTLILLDFGLVRRYKMESGEWREPRLR--------AGFRGTTRYVSIRVHRRCEQ 247

  Fly   202 SRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYC 266
            |..||:.|:.|.......|.|||:.::.:.:..:.:::..:....|  .|.:|..:....:....
 Worm   248 SPYDDLVSVMYTAYELLAGELPWKHLEKSEEVVQLKEVMTENGINP--ELFQGDKSVLIDFFKQV 310

  Fly   267 RSLRFEEQPDYMYLRQLFRILF--RTLNHQYDYIYDWTMLKQKTHQGQPNPAILLEQLDKDKEKQ 329
            ..:...::|.|..|.:..::|:  :.|...|::        :::.:||.         :..:|..
 Worm   311 SEMDPMKEPCYEKLIECIKVLYAPKVLTDPYEW--------EESSKGQD---------EVSEENT 358

  Fly   330 NGK 332
            |.|
 Worm   359 NSK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 73/276 (26%)
Pkinase_Tyr 23..284 CDD:285015 73/276 (26%)
T19D12.5NP_495349.1 PKc_like 61..329 CDD:389743 73/277 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.