DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and T15B12.2

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001367879.1 Gene:T15B12.2 / 188528 WormBaseID:WBGene00020531 Length:446 Species:Caenorhabditis elegans


Alignment Length:330 Identity:93/330 - (28%)
Similarity:154/330 - (46%) Gaps:32/330 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IGSGSFGDIYLGMSIQSGE-EVAIKMESAHARHPQLLYEAKLYR-ILSGGVGFPRIRH------H 82
            ||||.|||:|......:.: |.|:|.|...|:..:|..|..:.: |.:......:.||      .
 Worm    57 IGSGGFGDVYRVYDEPNPKMEYAMKTEVHGAQQRRLSIEKSILKEIDTYTTTHKKSRHFCELIDS 121

  Fly    83 GKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLM 147
            |:.|:::.:||.|:|||||.:.....|.:|...|:.:..|::..:|.:|...|||||:||.|...
 Worm   122 GQTKDYSWIVMTLIGPSLESVRRMLKRQYTKSCVINMALQILDAVEVMHEVGFIHRDLKPANICT 186

  Fly   148 GI-GRHCNKLFLIDFGLAKK-FRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDMESL 210
            |. .:..:.|:::|||:::: |:..........||.....||.:::|...|...:|.|:||||:.
 Worm   187 GTPPQDDHVLYVLDFGISRRVFKSSKCHELRNKRERVPFFGTRKFSSRACHQEKDQGRKDDMETY 251

  Fly   211 GYVM--MYFNRGVLPWQGMKANTKQQKYEKISEKK---MSTPIEVLCKGSPAEFSMYLNYCRSLR 270
            .|.:  ::.|...|.|....|:.     .||.|||   ...|.:.|.|..|:.....:.|.|.|:
 Worm   252 LYTILDLFHNERGLSWSKDLADV-----NKIIEKKHALFENPTKELDKIIPSGIDNIIVYLRGLK 311

  Fly   271 FEEQPDYMYLRQLFRILFRTL--NHQYDYIYDWT-MLKQKTHQGQPNPAI---------LLEQLD 323
            ||:..||..:....|...:.:  :...|...||| .|:|...:...|.|:         |.|:|.
 Worm   312 FEDPVDYRQIENELRTAGKKMAPSDSSDETMDWTGKLEQLLKEANKNKAVGTPKGEETLLYERLK 376

  Fly   324 KDKEK 328
            ..:::
 Worm   377 AKRDR 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 81/272 (30%)
Pkinase_Tyr 23..284 CDD:285015 81/272 (30%)
T15B12.2NP_001367879.1 STKc_TTBK 51..353 CDD:270919 88/300 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.