DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and F41G3.5

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_495378.2 Gene:F41G3.5 / 185631 WormBaseID:WBGene00018301 Length:331 Species:Caenorhabditis elegans


Alignment Length:293 Identity:91/293 - (31%)
Similarity:149/293 - (50%) Gaps:25/293 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRIL--SGGVGFPRIRHH 82
            |:|:|.|..|:||.:|....|.: ...|:|:||..:....|..||.:.|.|  .....|.|:...
 Worm    28 YKVVRFIAKGAFGAVYQVDHINT-LPFALKLESRSSETRNLKMEAVVLRSLLPIRSPYFCRVFFC 91

  Fly    83 GKEKNFNTLVMDLLGPSLEDLFNFC-TRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFL 146
            ||.:.||.|:|.|:|.:|.:|...| .|.|:.:|.|.:..|||..::.:|...||||||||.||.
 Worm    92 GKAEKFNFLIMTLVGKNLSELRANCPNRKFSRRTGLQIGIQMINAIQQLHSIGFIHRDIKPANFC 156

  Fly   147 MGIGRHCNKLFLIDFGLAKKF--------RDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSR 203
            :.:. :.::|.::|||:.:|:        |.|....|       ...||.|||.:..|.|.:..|
 Worm   157 INLD-NPHQLVMVDFGMCRKYLNDGGTQLRHPRWSVH-------GFRGTVRYAPLATHYGRDSCR 213

  Fly   204 RDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRS 268
            ::|:|::.||::....|.|||..|:.:...:..::::.   :|.:.....|.|.:....|.|..:
 Worm   214 KEDLETIFYVLVELLVGTLPWMTMEEHIHVEHSKQVAR---TTGLREFLSGCPKQLVHILLYIDN 275

  Fly   269 LRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDW 301
            |||.:.|||..:|.|  :.|...|.|::..::|
 Worm   276 LRFYDAPDYALIRGL--LSFALENCQHNGSFEW 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 86/274 (31%)
Pkinase_Tyr 23..284 CDD:285015 84/271 (31%)
F41G3.5NP_495378.2 PKc_like 28..292 CDD:389743 87/277 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.