DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and F39F10.2

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_510731.1 Gene:F39F10.2 / 185497 WormBaseID:WBGene00018202 Length:298 Species:Caenorhabditis elegans


Alignment Length:293 Identity:67/293 - (22%)
Similarity:127/293 - (43%) Gaps:42/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKM-ESAHARHPQLLYEAKLYRI--LSGGVGFPRI 79
            |.|.:.:.:|.||||.:.|....:|.|...:|: ......|....:..:.:.:  ||...|..::
 Worm     8 GNYTLGKVLGRGSFGSVQLAQDKRSNEMRVMKLIRKERDGHRDETWRRETFTLTALSDVSGVTKM 72

  Fly    80 RHHGKEKNFNTLVMDLLGPSLEDLFNFC----TRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDI 140
            ..:|..:..|.:||:.|.   :||....    |:.|:..|...::.|::..|:.||....:|.||
 Worm    73 FEYGSTETHNWIVMEQLS---DDLITIVRRNETKMFSKPTSYQIMWQLVKILQDIHAIGIVHTDI 134

  Fly   141 KPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRH------------HIVYREDKNLTGTARYASI 193
            |.||.::.......||.|:|:||:..|:| |.::            |:::...|..||       
 Worm   135 KADNLMVSYKNRVRKLVLVDYGLSCWFKD-HNQNRTPPAPFDNRCMHLIHTPAKTATG------- 191

  Fly   194 NAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAE 258
            :.|:..|     |:..:.|:....:: .:||:.::|    .|..|:.:|....|.:.|  |:..:
 Worm   192 HPHMEAE-----DLVQVAYLSCSLHQ-FMPWKDVEA----PKMTKMKKKFAKNPKKYL--GNHQD 244

  Fly   259 FSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTL 291
            ....:......:...:|||..:..|.:.:|.:|
 Worm   245 LKPIIKMLVKQKHGVEPDYEGILDLLQDMFGSL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 63/283 (22%)
Pkinase_Tyr 23..284 CDD:285015 62/279 (22%)
F39F10.2NP_510731.1 PKc_like 9..271 CDD:389743 64/284 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.