DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and D2024.1

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_501151.1 Gene:D2024.1 / 183947 WormBaseID:WBGene00017050 Length:359 Species:Caenorhabditis elegans


Alignment Length:333 Identity:85/333 - (25%)
Similarity:149/333 - (44%) Gaps:66/333 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YRVIRKIGSGSFGDIYLGMSIQSGEEVAIKME--------SAHARHPQLLYE-----AKLYRILS 71
            |:|:..||.|::|.::  ...::.::.|:|:|        ::..:..:::.|     ||.:.|..
 Worm    25 YQVVESIGDGAYGQVF--KVSKNAKKYAMKVEPNRLDGGPASITKEIEVMMELNNRGAKFFPIFE 87

  Fly    72 GGVGFPRIRHHGKEKNFNTLVMDLLGPSLEDL-FNFCT-RHFTIKTVLMLVDQMIGRLEYIHLKC 134
            .|         |:|..|:.:||.|||.:|:.| ...|. :..|..|...:..|.:..::.:|...
 Worm    88 TG---------GREPKFHMVVMTLLGENLQVLRMKGCNPKACTPGTWSRIGIQCLFVVKQMHDCG 143

  Fly   135 FIHRDIKPDNFLMGIGRH---CNKLFLIDFGLAKKFRDPHTRH----------HIVYR-EDK--- 182
            |:|.|:||.||:.|....   ....:|||||::.||    .||          ...:| |:|   
 Worm   144 FLHHDLKPANFVWGQSDEVLTSRVFYLIDFGISSKF----IRHIKGTPINQQNGFEFRTENKKVH 204

  Fly   183 NLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEK-KMST 246
            :|.||.:|.|..||...:..|.||..||.|::....: .|||:.::|        |:.|| |:.:
 Worm   205 SLVGTPKYTSPKAHAMADLGRGDDFWSLMYMIAELVK-PLPWEILEA--------KMLEKTKLKS 260

  Fly   247 PIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQK---- 307
            .::.| .|..| |.......::..|...|:|..:...|:.:|......:   ||.::.::|    
 Worm   261 KLKDL-YGIDA-FGKIETMLQACTFHSFPNYEMIYHAFKDVFTKSGASW---YDHSIGREKICRL 320

  Fly   308 THQGQPNP 315
            |:.|...|
 Worm   321 TNDGDRMP 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 77/296 (26%)
Pkinase_Tyr 23..284 CDD:285015 75/293 (26%)
D2024.1NP_501151.1 PKc_like 25..297 CDD:389743 77/297 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.