DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and ttbk-6

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_498080.1 Gene:ttbk-6 / 183478 WormBaseID:WBGene00016673 Length:290 Species:Caenorhabditis elegans


Alignment Length:273 Identity:75/273 - (27%)
Similarity:129/273 - (47%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRIRHHGKEKNFNTLVMDLLGPSLEDL--FNF 106
            |:..:|..:|:...|.:                |.:..:||:.||:.:||.|||.:|:||  .||
 Worm     2 EDHVLKKLNANGPAPHI----------------PNLNLYGKKMNFSYMVMTLLGRNLQDLESTNF 50

  Fly   107 -CTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNK---LFLIDFGLAKKF 167
             ..:.|:..|...:..|.:..|:|:|...||||::...|..:|..:...:   :.::||||.:.|
 Worm    51 VVNKGFSRGTWSRVGIQWVYALKYVHYNGFIHRNVNTQNLFLGNEKDSERAKIIHILDFGLGRPF 115

  Fly   168 RDPHTRHH----IVYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRG-VLPWQGM 227
            ...|.|.:    .:.|......|:.||||.|.||..||.|.||:.||.||::..|.| .||||  
 Worm   116 ARYHARENKWIVRIARHSAEFRGSFRYASPNVHLRKEQGRVDDVWSLPYVIIELNGGKALPWQ-- 178

  Fly   228 KANTKQQKYEKISEKKMS-TPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTL 291
                ...:..::.:.|:: ||.:|: ...||.....:.:..||.:.::||.   ..:|:..::.:
 Worm   179 ----TDYRRGRVEQMKLNLTPKDVM-SDMPACMDKLMPHLASLNYYQRPDD---HMIFKCFWQVM 235

  Fly   292 NHQY---DYIYDW 301
            .::.   ...:||
 Worm   236 ENEKITPSSKFDW 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 72/251 (29%)
Pkinase_Tyr 23..284 CDD:285015 72/251 (29%)
ttbk-6NP_498080.1 PKc_like 1..231 CDD:304357 73/254 (29%)
SPS1 2..287 CDD:223589 75/273 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.