DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and C14A4.13

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_496292.1 Gene:C14A4.13 / 182582 WormBaseID:WBGene00007563 Length:471 Species:Caenorhabditis elegans


Alignment Length:352 Identity:108/352 - (30%)
Similarity:158/352 - (44%) Gaps:55/352 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KESRPE----IIVGGKYRVIRKIGSGSFGDIYLGMSIQS-GEEVAIKMESAHARHPQLLYEAKLY 67
            ||..|:    .|:.|::..::.||.|::|.:|..:...| ....|.|.|.| ..|..|..|..|.
 Worm    10 KEKGPQCKLSTIINGQFMAVQMIGKGAYGVVYEVVRRNSPNTRFACKAELA-IDHNNLKTEWDLM 73

  Fly    68 RILSGGVGFPRIRHH------GKEKNFNTLVMDLLGPSLEDLFNFC-TRHFTIKTVLMLVDQMIG 125
            .:|...    :.:|:      |.|:|||.:||.|:||||.||.... .:.||:.|..:...|...
 Worm    74 TLLKDN----KSKHNIIGVELGSERNFNYIVMHLVGPSLSDLRKTVPNKTFTLFTTAVCAIQCFD 134

  Fly   126 RLEYIHLKCFIHRDIKPDNFLMGI-GRHCNKL-FLIDFGLA-------KKFRDPHTRHHIVYRED 181
            .|..|....:||||:||.||.:|: |....|| :::||||.       |:.|.|        |..
 Worm   135 SLVEIQRIGYIHRDVKPSNFAIGVLGSEEEKLVYVLDFGLCRNMFNKQKELRKP--------RMK 191

  Fly   182 KNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGM-KANTKQQKYEKISEKKMS 245
            ....||..|.|:|.|..:|..|.||..||.|:|:.|:...|||:.| |.:||:.|         .
 Worm   192 APFRGTILYCSLNIHQRMEPGRHDDFWSLLYMMIEFHLSDLPWENMSKEDTKKAK---------E 247

  Fly   246 TPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDW-------TM 303
            |.::.|....|.||.|...|..:|.:.::|||:.||::...:..:.....|...||       .:
 Worm   248 TKLDGLLARCPPEFRMIRCYLLTLTYSKEPDYVKLREVLCQIMTSKKFTPDMPLDWQKGGPCEAI 312

  Fly   304 LKQKT----HQGQPNPAILLEQLDKDK 326
            .|.:.    |:|......|.|.||..|
 Worm   313 FKPQAAVVKHKGTKKKVSLAELLDLPK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 92/282 (33%)
Pkinase_Tyr 23..284 CDD:285015 92/278 (33%)
C14A4.13NP_496292.1 PKc_like 29..286 CDD:389743 92/278 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.