DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and C03C10.2

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_497820.2 Gene:C03C10.2 / 182156 WormBaseID:WBGene00007269 Length:341 Species:Caenorhabditis elegans


Alignment Length:224 Identity:65/224 - (29%)
Similarity:110/224 - (49%) Gaps:16/224 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PEIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKME---SAHARHPQLLYEAKLYRILSGG 73
            |..|...::.:...||:|.:|.|::.|.::..:|.|:|:|   .|.....:::.|.::...:.|.
 Worm    42 PGSIFMNRWSIEGVIGNGGYGQIFMVMDVKKNDERAMKIEPKLRAEVITKRMIMEQQVLMKMQGK 106

  Fly    74 VGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTR----HFTIKTVLMLVDQMIGRLEYIHLKC 134
            ...|.:...|....||.::|.||..::.|   |..|    ..:.:||..:..|.:..|:.||...
 Worm   107 THIPTMYASGFNDQFNFIIMQLLSMNVGD---FRKRSPLGRLSKETVGRIAYQTLNALKDIHDMG 168

  Fly   135 FIHRDIKPDNFLMGI---GRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAH 196
            ::|||:||.|...|:   .||.  |:|:||||.::|: ..:...|.:|.:....||.||.|:..|
 Worm   169 YVHRDVKPANICFGVHAQNRHI--LYLLDFGLVRRFK-TESGVCIPWRINAGFKGTERYVSVRVH 230

  Fly   197 LGIEQSRRDDMESLGYVMMYFNRGVLPWQ 225
            ..:||:..||..|:.|.......|.|||:
 Worm   231 EKLEQTPWDDAFSVLYTAYELVVGELPWR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 63/217 (29%)
Pkinase_Tyr 23..284 CDD:285015 63/213 (30%)
C03C10.2NP_497820.2 PKc_like 49..317 CDD:304357 63/217 (29%)
Pkinase 50..303 CDD:278497 63/216 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.