DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and B0218.5

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_501367.1 Gene:B0218.5 / 181853 WormBaseID:WBGene00015049 Length:367 Species:Caenorhabditis elegans


Alignment Length:278 Identity:89/278 - (32%)
Similarity:138/278 - (49%) Gaps:24/278 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRIRH-- 81
            :|:|:..:|.|.:|.:|..:.:...|:.|||.|:|.|....|..:..:.:    |....:.||  
 Worm    23 RYKVLALLGKGGYGAVYSVLRLSDMEKFAIKCENAAACRKALYMDCNVLK----GAAKIQSRHFC 83

  Fly    82 ----HGKEKN-FNTLVMDLLGPSLEDL-FNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDI 140
                ....|| ||.:||.|:|.:|.|| .:.....||..|.|....|.:..:|.:|...|:||||
 Worm    84 TVIDQAAVKNRFNFIVMKLIGKNLWDLRMDTAECRFTKGTSLKAASQCLISIEELHRFGFLHRDI 148

  Fly   141 KPDNFLMG---IGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQS 202
            ||.||.:|   ...| :.:|::||||.::|...........|......||.|||.||:.|.|:..
 Worm   149 KPGNFAVGRKESNEH-HTIFMLDFGLCREFVKRGEGRLRTQRAKSQFRGTTRYAPINSMLEIDTG 212

  Fly   203 RRDDMESLGYVMMYFNRGVLPWQGMKANTKQQ--KYEK--ISEKKMSTPIEVLCKGSP-AEFSMY 262
            |:||:||..|::..:..|.|||:..||..:::  ||:|  .::|::...:...|   | .||...
 Worm   213 RKDDIESWLYMVAEWTSGGLPWRKFKATEREKVLKYKKDVRTDKEIMADLFYNC---PLKEFERI 274

  Fly   263 LNYCRSLRFEEQPDYMYL 280
            |.|...|.|..:|||.::
 Worm   275 LKYVDELDFYSEPDYKFV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 89/278 (32%)
Pkinase_Tyr 23..284 CDD:285015 87/274 (32%)
B0218.5NP_501367.1 PKc_like 23..297 CDD:389743 89/278 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.