DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and kin-20

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001024669.1 Gene:kin-20 / 181620 WormBaseID:WBGene00002203 Length:497 Species:Caenorhabditis elegans


Alignment Length:299 Identity:193/299 - (64%)
Similarity:241/299 - (80%) Gaps:3/299 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KESRPEIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSG 72
            |::..|:.||.::|:.||||||||||||||.:||:.||||:|:|...::||||..|::||||:.|
 Worm   179 KKAEMELRVGNRFRLGRKIGSGSFGDIYLGQNIQTNEEVAVKLECVKSKHPQLHIESRLYRIMLG 243

  Fly    73 GVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIH 137
            |:|.|.||..|:|.::|.:||:|||||||||||||.|.|::||||:|.|||:.|:|:||.:.:||
 Worm   244 GIGIPEIRWCGQEGDYNVMVMELLGPSLEDLFNFCQRKFSLKTVLLLADQMLSRVEFIHCRDYIH 308

  Fly   138 RDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRH-HIVYREDKNLTGTARYASINAHLGIEQ 201
            |||||||||||:|:..|.:::|||||||::||  ::| ||.|||:|||||||||||||.|.||||
 Worm   309 RDIKPDNFLMGLGKRGNLVYIIDFGLAKRYRD--SKHQHIAYRENKNLTGTARYASINTHRGIEQ 371

  Fly   202 SRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYC 266
            |||||:||||||.||||||.|||||:||.||:||||.|||||:||.::.||.|.|..|:.|||||
 Worm   372 SRRDDIESLGYVFMYFNRGTLPWQGLKAVTKRQKYELISEKKISTRVDDLCAGYPEAFAQYLNYC 436

  Fly   267 RSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLK 305
            |||.|||||||.|||.|||.||......|||::||...|
 Worm   437 RSLGFEEQPDYGYLRNLFRTLFHRQQFCYDYVFDWNTYK 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 178/265 (67%)
Pkinase_Tyr 23..284 CDD:285015 177/261 (68%)
kin-20NP_001024669.1 STKc_CK1_delta_epsilon 190..463 CDD:271027 183/274 (67%)
S_TKc 191..421 CDD:214567 155/231 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X224
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.