DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and F38E1.3

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_505159.1 Gene:F38E1.3 / 179220 WormBaseID:WBGene00018178 Length:310 Species:Caenorhabditis elegans


Alignment Length:304 Identity:86/304 - (28%)
Similarity:144/304 - (47%) Gaps:41/304 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHP-QLLYEAKLYRILSG---GVGFPRIR 80
            |.:.:.:|.|.||.:|.....::|...|:|:|....:.| :|..|..:.:::..   ...|.:|.
 Worm    25 YVIDKLLGEGGFGAVYKVKDSKTGNFYAMKVEKKQEKKPSKLKMEIMILKLVCNERQTSHFTKII 89

  Fly    81 HHGK--EKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPD 143
            ..||  ::.|..|||:|.|.||.||.....:.||..|.|.:..|.:...|.:|...|||||:||.
 Worm    90 DRGKKDKEGFFFLVMELAGSSLADLKRNRGKAFTCPTGLSVSQQCLEACEDLHKHGFIHRDLKPA 154

  Fly   144 NFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLT--------GTARYASINAHLGIE 200
            ||..|.....:.::::|||::::         |:..::|..|        ||.::||::.|.|||
 Worm   155 NFACGADDKQHTIYILDFGISRR---------IINNQNKLKTPRVTIRFKGTLKFASLSCHKGIE 210

  Fly   201 QSRRDDMESLGYVMMYFNRGVLP----WQGMKANTK----QQKYEKISEKKMSTPIEVLCKGSPA 257
            ...:||.||..|:::..   ::|    |:|  ||.|    :.|.|...:|:|...|:  |   ..
 Worm   211 MGWKDDCESWFYMLLDL---IVPFGLVWRG--ANDKDTVCKLKEEARGKKEMFQGIK--C---GV 265

  Fly   258 EFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDW 301
            |.:..:.|...|::::..||.|:.:.......|.....|..|||
 Worm   266 ELNKIIVYIDKLQYQDHVDYQYIYKTLVDACDTCGGNMDAPYDW 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 81/285 (28%)
Pkinase_Tyr 23..284 CDD:285015 80/282 (28%)
F38E1.3NP_505159.1 PKc_like 24..292 CDD:389743 81/285 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.