DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and C38C3.4

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001023703.2 Gene:C38C3.4 / 178641 WormBaseID:WBGene00016513 Length:330 Species:Caenorhabditis elegans


Alignment Length:311 Identity:94/311 - (30%)
Similarity:145/311 - (46%) Gaps:35/311 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IVGGK---YRVIRKIGSGSFGDIYLGMSIQSGEEVAIKME--SAHARHPQLLYEAKLYRILSGGV 74
            ::.||   |.|.:|:..|.:|.:|..:....|:..|.|:|  .||:......|.........|..
 Worm    28 LIRGKDSVYAVGKKVAQGRYGAVYEVLRRSDGKPFACKLEICEAHSHGLDQDYSVMTKAAKRGAE 92

  Fly    75 GFPRIRHHGK-EKNFNTLVMDLLGPSLEDL-FNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIH 137
            ...|:...|| |::|..::|.|||.:|.:| |.|....|::.|.|.|....|..::.:|...::|
 Worm    93 NLVRMIDRGKIEEHFKFIIMPLLGENLMNLRFLFEDGRFSLSTGLRLALFAIQPIQSLHQLGYVH 157

  Fly   138 RDIKPDNFLMGIGR--HCN----KLFLIDFGLAKKFRD-------PHTRHHIVYREDKNLTGTAR 189
            ||||..||.:...:  |.|    ||.|||:|:.:.|:|       |.|        |....||.|
 Worm   158 RDIKASNFCIADPQMLHQNPEALKLCLIDYGICRSFKDKSGELKTPRT--------DIKFRGTNR 214

  Fly   190 YASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIE---VL 251
            |||:.||.|.|||.:|||||..|:|:....|.|||..|.   :.|..|..|.|:.....:   ::
 Worm   215 YASLAAHYGDEQSAKDDMESWFYMMIELISGNLPWSFMH---RDQHKEVASMKEACRTTDGSLIM 276

  Fly   252 CKGSP-AEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDW 301
            .|..| .||.....|...|:::...||.::.::.::..|....:.:..:||
 Worm   277 MKFCPRVEFHRIQAYLMGLKYQNTVDYTFISEMVQLAMRNNGVRMNEKFDW 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 90/288 (31%)
Pkinase_Tyr 23..284 CDD:285015 87/281 (31%)
C38C3.4NP_001023703.2 PKc_like 36..308 CDD:389743 89/282 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.