DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and F36H12.9

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_500758.1 Gene:F36H12.9 / 177303 WormBaseID:WBGene00018123 Length:380 Species:Caenorhabditis elegans


Alignment Length:295 Identity:90/295 - (30%)
Similarity:143/295 - (48%) Gaps:57/295 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRIRHH- 82
            ||:||..:|.|.:|.:|..:.:...|:.|||.|.|.|....||.:..:.:    |....:.||. 
 Worm    23 KYKVIALLGKGGYGAVYSVLRLSDMEKFAIKCEKATAGKKVLLMDCNVMK----GATQIKSRHFC 83

  Fly    83 ------GKEKNFNTLVMDLLGPSLEDLFNFCTRH------FTIKTVLMLVDQMIGRLEYIHLKCF 135
                  ..:..||.:||.|:|.:|.||     |.      ||:.|.|....|.:..:|::|...:
 Worm    84 TVLDRANVKDRFNFIVMKLIGKNLWDL-----RQDRGDGKFTMGTSLKAASQCLVSIEHLHSFGY 143

  Fly   136 IHRDIKPDNFLMGIGRHCNK---LFLIDFGLAKKFRDPHTRHHIVYREDKNL---------TGTA 188
            :||||||.||..| .:..|:   :|::||||.        |.::...|.|:|         .||.
 Worm   144 LHRDIKPGNFAAG-RKESNEHHVIFMLDFGLC--------REYVKRAEGKDLRAARTTAPFRGTT 199

  Fly   189 RYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKK--MSTPIEV- 250
            |||.:.:.|..:|||:||:||..|:::.:..|.|||:.:||:.:    ||:.:.|  :.|..:: 
 Worm   200 RYAPLASMLQQDQSRKDDIESWLYMVVEWTSGGLPWRKLKAHDR----EKVLQYKQDLRTKPDIL 260

  Fly   251 -----LCKGSPAEFSMYLNYCRSLRFEEQPDYMYL 280
                 ||  ...||:..|.|..:|.:...|||.::
 Worm   261 DDFLFLC--PKKEFTRILKYLDTLGYYAVPDYKFI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 90/295 (31%)
Pkinase_Tyr 23..284 CDD:285015 87/291 (30%)
F36H12.9NP_500758.1 PKc_like 23..296 CDD:389743 90/295 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.