DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and R13H9.5

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_500715.1 Gene:R13H9.5 / 177276 WormBaseID:WBGene00020071 Length:311 Species:Caenorhabditis elegans


Alignment Length:299 Identity:83/299 - (27%)
Similarity:139/299 - (46%) Gaps:33/299 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILS--GGVGFPRIRH 81
            ::.:.:|:|.|..|.:||  ...:..:.|:|:|........|..|..:...|:  |...|.:|..
 Worm    19 RWSITKKLGEGGCGAVYL--CTDATGKYALKVEGISEAMQVLKMEVLVLGELTKRGSRHFCKIED 81

  Fly    82 HGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLV------DQMIGRLEYIHLKCFIHRDI 140
            .|:..:||.:||.|:|.||:||     |..|.:..|.|.      .|.:..||.:|...::|||:
 Worm    82 KGRYGSFNYVVMTLVGKSLQDL-----RKGTAQQCLSLACSLSVGIQSLEALEDLHNIGYLHRDV 141

  Fly   141 KPDNFLMGIG--RHCNKLFLIDFGLAKKFRDPHTRHHIVYREDK---NLTGTARYASINAHLGIE 200
            ||.|:.:|..  ....|::::|||:|:||.|    ::.|.|:.:   ...||.|||.|..|...|
 Worm   142 KPGNYTIGRAELNELRKVYILDFGMARKFTD----NNGVIRKPRAAAGFRGTVRYAPIACHKNQE 202

  Fly   201 QSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPA-EFSMYLN 264
            ..|:||:|...|:.:....|.:||   |..|......:..:...:||.::.....|| |....:.
 Worm   203 LGRKDDVEVWLYMQVELTVGRVPW---KEITDMNAVGQAKQTIRNTPEKMFVFPCPANELKEIMK 264

  Fly   265 YCRSLRFEEQPDYMYLRQLFRILFRTLNH--QYDYIYDW 301
            ...|..:...|:|   ...:|::.:.|.:  :.:|.|||
 Worm   265 MVDSWDYFADPNY---ADCYRLMKQALANCGKPEYPYDW 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 77/278 (28%)
Pkinase_Tyr 23..284 CDD:285015 77/274 (28%)
R13H9.5NP_500715.1 STKc_TTBK 19..285 CDD:270919 78/282 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.