DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and C09B9.4

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_500708.1 Gene:C09B9.4 / 177271 WormBaseID:WBGene00015629 Length:359 Species:Caenorhabditis elegans


Alignment Length:313 Identity:87/313 - (27%)
Similarity:142/313 - (45%) Gaps:40/313 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMES-AHARHPQLLYEAKLYRILSGGVGFPRIRHHG 83
            |::...|.:|.|..::|  ..:.|...|:|:|| :....|.|..:..:.|.|....|||.:...|
 Worm    29 YKMCDSIATGPFSSVFL--VEKDGIPYAMKVESQSKCLRPVLKLDHAVLRALGHQSGFPSLTSAG 91

  Fly    84 KEKNFNTLVMDLLGPSLEDLFNFC-TRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLM 147
            :.:||..:||.|:||.|..|..|. .:.||..||..:..|.:.||..:|...:::||:|..||.:
 Worm    92 RTENFKYVVMQLVGPDLSMLLEFAPQQRFTSSTVYKIALQTLDRLRVLHEAGWLNRDVKAQNFAV 156

  Fly   148 GIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGI-EQSRRDDMESLG 211
            |:|...:.::::||||.:|:.: |.....:.|......||..||.: |.||. :||..||:|...
 Worm   157 GLGEESSIVYMLDFGLTRKYLE-HNGSRSLLRPHGPSVGTFPYAPL-ASLGFCDQSPIDDIEGWL 219

  Fly   212 YVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCK----------GSPAEFSMYLNYC 266
            |::::..:|.|||...|   :.....|:.|.||      .|:          |.|..::...:..
 Worm   220 YMIVHLLKGGLPWHNSK---RALNLPKVREWKM------YCRRPGGKHYLFAGIPKGWADIFDVI 275

  Fly   267 RSLRFEEQPDYMYLRQLFRILFRTLNHQYDYI--YDWTMLKQKTHQGQPNPAI 317
            .:....|.|||..:..:  :|....|...|..  :||          |.||.:
 Worm   276 VNTAPHETPDYNKIANM--VLSIARNELIDLTAPFDW----------QVNPVL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 79/276 (29%)
Pkinase_Tyr 23..284 CDD:285015 78/273 (29%)
C09B9.4NP_500708.1 PKc_like 29..289 CDD:389743 79/272 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.