DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and F26A1.3

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_497999.1 Gene:F26A1.3 / 175639 WormBaseID:WBGene00017802 Length:512 Species:Caenorhabditis elegans


Alignment Length:270 Identity:66/270 - (24%)
Similarity:107/270 - (39%) Gaps:66/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GKEKNFNTLVMDLLGPSLEDLFNFCTRHFT-IKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFL 146
            |....|...|||:   :||.|.......|. :.:..:..:.||| ::..|.:..|||||||.|.|
 Worm   257 GGSPYFTMPVMDV---NLERLKQQIGHKFRWVDSFYIGQESMIG-IKECHDRSIIHRDIKPTNLL 317

  Fly   147 MGIGRHCNK----LFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRD-- 205
            :     |.:    .:|.|||.:.:..:.    .|:...|   ..|..|.|..||...::..:.  
 Worm   318 L-----CREPNMFWWLCDFGDSCRIGEV----KIISPPD---ALTLPYLSRAAHEATQKPMKATI 370

  Fly   206 --DMESLGYVMM-YFNRGVLPWQGM--KANTKQQK----------YEKISEK--KMSTPIEVLCK 253
              |:||..|::: .|  .||||:.|  :|.|...|          ::|.:.|  ....||..:..
 Worm   371 AMDIESWFYMLLDLF--VVLPWKNMVEEAPTLAAKTAFWANLTEFFQKRAAKLPPQLLPIAQIVG 433

  Fly   254 GSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKTHQGQPNPAIL 318
            .|..               |:| |:.|:.:.|..|...|.:..:..||  :.::|      |...
 Worm   434 NSSI---------------EKP-YIQLKTILRDGFDKNNAKQPWKPDW--ITKRT------PPKA 474

  Fly   319 LEQLDKDKEK 328
            ..::.:.|||
 Worm   475 SAEMARSKEK 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 56/224 (25%)
Pkinase_Tyr 23..284 CDD:285015 56/224 (25%)
F26A1.3NP_497999.1 PKc_like 208..432 CDD:389743 51/192 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.