DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and C09D4.3

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_491610.1 Gene:C09D4.3 / 172202 WormBaseID:WBGene00015634 Length:406 Species:Caenorhabditis elegans


Alignment Length:335 Identity:99/335 - (29%)
Similarity:158/335 - (47%) Gaps:56/335 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILS----GGVGFP 77
            |.::.:.:|:|.|:.|.::|  ||..|..||||.|....  ..|..|.|:  :||    .||.|.
 Worm    85 GDRFILRQKLGDGAMGHVFL--SIFGGRSVAIKAEKYST--GMLPMEIKV--LLSIRRHNGVHFC 143

  Fly    78 RIRHHGK-EKNFNTLVMDLLGPSLEDLFNF----CTRHFTIKTVLMLVDQMIGRLEYIHLKCFIH 137
            .|..:|. .:.:|.:::.:||   :||:..    .||.||:.|...:..:.|..:|.:|...::.
 Worm   144 DIIDYGTIRREYNYMIISILG---KDLYRLRAEQPTRSFTLNTTTKIALETIEAIEELHNIGYLS 205

  Fly   138 RDIKPDNFLMG---IGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNL--------TGTARYA 191
            ||:||.||..|   .|:| ..:|:.||||||||.|         |::|.|        .||.||.
 Worm   206 RDVKPSNFAPGQRDNGQH-KTIFMFDFGLAKKFID---------RDNKKLKSRGEVGWRGTVRYG 260

  Fly   192 SINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIE---VLCK 253
            |:.||..::..||||:|...|:::....|.|||:.|...|      .:.:.|:|...|   :...
 Worm   261 SLQAHKRMDLGRRDDVECWFYMLIEMLVGELPWRHMSDRT------LVGQSKLSIRNESRRLFFN 319

  Fly   254 GSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYI-YDWTMLKQ------KTHQG 311
            .:|.:|...::......||.:|:|.:|:.|...: |..|...|.. :||.:.:.      :|...
 Worm   320 RTPRQFETIMDMIDGYSFEIRPEYRHLKALINEI-RMENMIPDRCKWDWQVEESQHSELTETASV 383

  Fly   312 QPNPAILLEQ 321
            ..:.||:.||
 Worm   384 MSDMAIMAEQ 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 87/287 (30%)
Pkinase_Tyr 23..284 CDD:285015 87/283 (31%)
C09D4.3NP_491610.1 PKc_like 87..343 CDD:389743 85/280 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.