DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and Y65B4A.9

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001293249.1 Gene:Y65B4A.9 / 171658 WormBaseID:WBGene00022032 Length:391 Species:Caenorhabditis elegans


Alignment Length:239 Identity:75/239 - (31%)
Similarity:117/239 - (48%) Gaps:37/239 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVG------- 75
            |.|.|.:.:.:|:||.||.......|:..|:|.|:       |..::.|.|.:|..:.       
 Worm    19 GTYEVTKPLATGTFGSIYKVKRESDGKFFAVKCEA-------LNMKSSLLRQMSVVLASIHHPSP 76

  Fly    76 -FPRIRHHGKEKN-FNTLVMDLLGPSLEDLFNFCT--RHFTIKTVLMLVDQMIGRLEYIHLKCFI 136
             |..|...|...| |..:||.|.|.:|.:|.....  |.|::.|.|.|.:|.:..:..:|...||
 Worm    77 FFTNIEERGTVPNRFLFIVMPLYGENLYELMMNTNKDRKFSMATGLHLAEQTLAAIRDLHRNGFI 141

  Fly   137 HRDIKPDNFLMG---IGRHCNKLFLIDFGLAKKFR---------DPHTRHHIVYREDKNLTGTAR 189
            ||||||.:|.:|   .|:| ::::|:||||.|:.|         :...::.|.||      |..:
 Worm   142 HRDIKPSHFCIGREIDGQH-HQVYLLDFGLCKRPRFVKKNDEAEEQMRKNAIHYR------GVVK 199

  Fly   190 YASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQ 233
            |||::||.|.....:|||||..|:::.|..|.|||..:...::|
 Worm   200 YASVHAHQGKNLGYKDDMESWWYMVLEFFLGALPWALLNKESEQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 74/238 (31%)
Pkinase_Tyr 23..284 CDD:285015 72/234 (31%)
Y65B4A.9NP_001293249.1 STKc_TTBK 20..302 CDD:270919 74/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.